PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_150530_jqqr.t1
Common NameFL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22730.9 Da    PI: 9.4598
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_150530_jqqr.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krie+ks rqvtfskRr g++KKA ELS+LCd++vav++fs++g+lye+ 
  Bv6_150530_jqqr.t1  9 KRIEDKSSRQVTFSKRRSGLIKKARELSILCDVDVAVLVFSNRGRLYEFV 58
                        79**********************************************96 PP

2K-box36.52.1e-13971632187
               K-box  21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                          a ++   e  ++  R l G +Le+L l++ ++Le+qL ++l + R++K++ll+++ e+l+    +l
  Bv6_150530_jqqr.t1  97 CAEVQTCGELVKSVERYLEGPELENLRLEDFMRLERQLADALVQTRTRKEKLLKQENEQLKDEVANL 163
                         44444555556667788*******************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.936161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-30178IPR002100Transcription factor, MADS-box
CDDcd002657.02E-36280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.31590186IPR002487Transcription factor, K-box
PfamPF014861.6E-8107163IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGRRKIEMKR IEDKSSRQVT FSKRRSGLIK KARELSILCD VDVAVLVFSN RGRLYEFVNS  60
SSSSSLSQIL KRYQDSTAAD GKASIAAVET ESSPSSCAEV QTCGELVKSV ERYLEGPELE  120
NLRLEDFMRL ERQLADALVQ TRTRKEKLLK QENEQLKDEV ANLIGIPKSR NHKDLGVNNL  180
MEVDADRQYS QPLRTLPLLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-17175171Myocyte-specific enhancer factor 2B
1tqe_Q1e-17175171Myocyte-specific enhancer factor 2B
1tqe_R1e-17175171Myocyte-specific enhancer factor 2B
1tqe_S1e-17175171Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1892120.0DQ189212.1 Beta vulgaris FLC-like 1 splice variant 3 (FL1) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010682734.11e-143PREDICTED: MADS-box transcription factor 23-like isoform X4
TrEMBLA2CHJ61e-143A2CHJ6_BETVU; FLC-like 1 splice variant 3
TrEMBLA2T9D31e-143A2T9D3_BETVU; FLC-like 1 splice variant 3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.43e-34MIKC_MADS family protein
Publications ? help Back to Top
  1. Reeves PA, et al.
    Evolutionary conservation of the FLOWERING LOCUS C-mediated vernalization response: evidence from the sugar beet (Beta vulgaris).
    Genetics, 2007. 176(1): p. 295-307
    [PMID:17179080]